Lineage for d2iuja2 (2iuj A:164-853)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008080Fold a.119: Lipoxigenase [48483] (1 superfamily)
    multihelical
    large nearly all-alpha domain
  4. 2008081Superfamily a.119.1: Lipoxigenase [48484] (3 families) (S)
  5. 2008082Family a.119.1.1: Plant lipoxigenases [48485] (2 protein domains)
    automatically mapped to Pfam PF00305
  6. 2008115Protein automated matches [226915] (1 species)
    not a true protein
  7. 2008116Species Soybean (Glycine max) [TaxId:3847] [225162] (2 PDB entries)
  8. 2008117Domain d2iuja2: 2iuj A:164-853 [204863]
    Other proteins in same PDB: d2iuja1
    automated match to d1fgoa1
    complexed with fe

Details for d2iuja2

PDB Entry: 2iuj (more details), 2.4 Å

PDB Description: Crystal Structure of Soybean Lipoxygenase-B
PDB Compounds: (A:) lipoxygenase l-5

SCOPe Domain Sequences for d2iuja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iuja2 a.119.1.1 (A:164-853) automated matches {Soybean (Glycine max) [TaxId: 3847]}
lpsetpaplvkyreeelknvrgdgtgerkewdriydydvyndlgdpdkgekyarpvlggs
alpyprrgrtgrgktrkdpnsekpgdfvylprdeafghlkssdflaygiksvaqdvlpvl
tdafdgnllsldfdnfaevrklyeggvtlptnflsnitpipiikelfrtdgeqflkyppp
kvmqvdksawmtdeefaretiaglnpnvikiieefplsskldtqaygdhtciitkehlep
nlggltveqaiqnkklfildhhdylipylrkinanttktyatrtifflkndgtltplaie
lskphpqgeeygpvsevyvpssegveayiwllakayvvvndacyhqiishwlnthavvep
fviatnrhlsvvhpiykllfphyrdtmninslarkslvnadgiiektflwgryslemsav
iykdwvftdqalpndlvkrgvavkdpsaphgvrlliedypyasdgleiwdaikswveeyv
sfyyksdeelqkdpelqawwkelvevghgdlkdkpwwqkmqtreelveasatliwiasal
haavnfgqypygglilnrptisrrfmpekgspeydalaknpekeflktitgkketlidlt
iieilsrhasdefylgqrdggdywtsdagpleafkrfgknleeiekklieknndetlrnr
ygpakmpytllypsseegltfrgipnsisi

SCOPe Domain Coordinates for d2iuja2:

Click to download the PDB-style file with coordinates for d2iuja2.
(The format of our PDB-style files is described here.)

Timeline for d2iuja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iuja1