SCOPe 2.08: Domain d2iuja1: 2iuj A:8-163

Lineage for d2iuja1 (2iuj A:8-163)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families)

5. Family b.12.1.0: automated matches [227174] (1 protein)
   not a true family

6. Protein automated matches [226891] (5 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [225161] (2 PDB entries)

8. Domain d2iuja1: 2iuj A:8-163 [204862]
   Other proteins in same PDB: d2iuja2
   automated match to d3bnba2
   complexed with fe

Details for d2iuja1

PDB Entry: 2iuj, 2.4 Å

PDB Description: Crystal Structure of Soybean Lipoxygenase-B

PDB Compounds: (A:) lipoxygenase l-5

SCOPe Domain Sequences for d2iuja1:

Sequence, based on SEQRES records:

>d2iuja1 b.12.1.0 (A:8-163) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gqkikgtmvvmqknvldinsitsvdgivgtgldflgsaldtvtflassisiqlisatkad
ggkgkvgkatnlrgkitlptigakeeaydaqfdwdsdfgipgafyiknymqnefylksli
ledipnhgtihficnswvynskhyktdriffannty

Sequence, based on observed residues (ATOM records):

>d2iuja1 b.12.1.0 (A:8-163) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gqkikgtmvvmqknvldinsitsvaldtvtflassisiqlisatkadggkgkvgkatnlr
gkitlptigakeeaydaqfdwdsdfgipgafyiknymqnefylksliledipnhgtihfi
cnswvynskhyktdriffannty

Timeline for d2iuja1:

• d2iuja1 first appeared in SCOPe 2.03
  
• d2iuja1 appears in SCOPe 2.07