![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.119: DAK1/DegV-like [82548] (1 superfamily) 2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest] |
![]() | Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) ![]() domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different |
![]() | Family c.119.1.0: automated matches [191443] (1 protein) not a true family |
![]() | Protein automated matches [190655] (13 species) not a true protein |
![]() | Species Lactococcus lactis [TaxId:1358] [188636] (3 PDB entries) |
![]() | Domain d2iu6b1: 2iu6 B:2-328 [204861] Other proteins in same PDB: d2iu6a2, d2iu6b2 automated match to d2iu4b_ complexed with gol |
PDB Entry: 2iu6 (more details), 2 Å
SCOPe Domain Sequences for d2iu6b1:
Sequence, based on SEQRES records: (download)
>d2iu6b1 c.119.1.0 (B:2-328) automated matches {Lactococcus lactis [TaxId: 1358]} efynstneipeemlkgidltypqltylpetgilydntynektvpiisgggsghepahvgy vgsgmlaaavtgplfippksknilkairqvnsgkgvfviiknfeadlkefneaikearte gidvryivshddisvnaynfhkrhrgvagtillhkilgafakeggsideieqlalslspe iytlgvalapvhfphqktsfvlaedevsfgigihgepgyrvekfegseriaielvnklka einwqkkanknyillvnglgsttlmelysfqydvmrlleleglsvkfckvgnlmtscdms gisltlcsvkdpkwldylnvptgafaw
>d2iu6b1 c.119.1.0 (B:2-328) automated matches {Lactococcus lactis [TaxId: 1358]} efynstneipeemlkgidltypqltylpetgilydntynektvpiisgggsghepahvgy vgsgmlaaavtgplfippksknilkairqvnsgkgvfviiknfeadlkefneaikearte gidvryivshddisvnaynfhkrhrgvagtillhkilgafakeggsideieqlalslspe iytlgvalapvdevsfgigihgepgyrvekfegseriaielvnklkaeinwqkkanknyi llvnglgsttlmelysfqydvmrlleleglsvkfckvgnlmtscdmsgisltlcsvkdpk wldylnvptgafaw
Timeline for d2iu6b1: