Lineage for d2iu6a1 (2iu6 A:2-328)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150492Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 2150493Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 2150540Family c.119.1.0: automated matches [191443] (1 protein)
    not a true family
  6. 2150541Protein automated matches [190655] (10 species)
    not a true protein
  7. 2150549Species Lactococcus lactis [TaxId:1358] [188636] (3 PDB entries)
  8. 2150552Domain d2iu6a1: 2iu6 A:2-328 [204860]
    Other proteins in same PDB: d2iu6a2, d2iu6b2
    automated match to d2iu4b_
    complexed with gol

Details for d2iu6a1

PDB Entry: 2iu6 (more details), 2 Å

PDB Description: regulation of the dha operon of lactococcus lactis
PDB Compounds: (A:) dihydroxyacetone kinase

SCOPe Domain Sequences for d2iu6a1:

Sequence, based on SEQRES records: (download)

>d2iu6a1 c.119.1.0 (A:2-328) automated matches {Lactococcus lactis [TaxId: 1358]}
efynstneipeemlkgidltypqltylpetgilydntynektvpiisgggsghepahvgy
vgsgmlaaavtgplfippksknilkairqvnsgkgvfviiknfeadlkefneaikearte
gidvryivshddisvnaynfhkrhrgvagtillhkilgafakeggsideieqlalslspe
iytlgvalapvhfphqktsfvlaedevsfgigihgepgyrvekfegseriaielvnklka
einwqkkanknyillvnglgsttlmelysfqydvmrlleleglsvkfckvgnlmtscdms
gisltlcsvkdpkwldylnvptgafaw

Sequence, based on observed residues (ATOM records): (download)

>d2iu6a1 c.119.1.0 (A:2-328) automated matches {Lactococcus lactis [TaxId: 1358]}
efynstneipeemlkgidltypqltylpetgilydntynektvpiisgggsghepahvgy
vgsgmlaaavtgplfippksknilkairqvnsgkgvfviiknfeadlkefneaikearte
gidvryivshddisvnaynfhkrhrgvagtillhkilgafakeggsideieqlalslspe
iytlgvalevsfgigihgepgyrvekfegseriaielvnklkaeinwqkkanknyillvn
glgsttlmelysfqydvmrlleleglsvkfckvgnlmtscdmsgisltlcsvkdpkwldy
lnvptgafaw

SCOPe Domain Coordinates for d2iu6a1:

Click to download the PDB-style file with coordinates for d2iu6a1.
(The format of our PDB-style files is described here.)

Timeline for d2iu6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iu6a2