Lineage for d1fl3a1 (1fl3 A:2-116)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287296Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (14 PDB entries)
  8. 287309Domain d1fl3a1: 1fl3 A:2-116 [20486]
    Other proteins in same PDB: d1fl3a2, d1fl3b1, d1fl3b2, d1fl3h2, d1fl3l1, d1fl3l2
    part of blue fluorescent Fab 19G2
    complexed with spb

Details for d1fl3a1

PDB Entry: 1fl3 (more details), 2.45 Å

PDB Description: crystal structure of the blue fluorescent antibody (19g2) in complex with stilbene hapten at 277k

SCOP Domain Sequences for d1fl3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl3a1 b.1.1.1 (A:2-116) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1}
aallesggglvkpggslklsctasgitfsryimswvrqipekrlewvasissggityypd
svagrftisrdnvrnilylqmsslrsedtalyycargqgrpywgqgtsvtvsa

SCOP Domain Coordinates for d1fl3a1:

Click to download the PDB-style file with coordinates for d1fl3a1.
(The format of our PDB-style files is described here.)

Timeline for d1fl3a1: