SCOPe 2.08: Domain d2iu3a1: 2iu3 A:4-200

Lineage for d2iu3a1 (2iu3 A:4-200)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families)
   contains a common phosphate-binding site

5. Family c.24.1.3: Inosicase [63971] (1 protein)

6. Protein IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC [63972] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [63973] (9 PDB entries)
   Uniprot P31335

8. Domain d2iu3a1: 2iu3 A:4-200 [204856]
   Other proteins in same PDB: d2iu3a2, d2iu3b2
   automated match to d1g8ma1
   complexed with 203, k

Details for d2iu3a1

PDB Entry: 2iu3, 2.9 Å

PDB Description: crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase

PDB Compounds: (A:) Bifunctional purine biosynthesis protein PURH

SCOPe Domain Sequences for d2iu3a1:

Sequence; same for both SEQRES and ATOM records:

>d2iu3a1 c.24.1.3 (A:4-200) IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]}
rqqlallsvsekaglvefarslnalglgliasggtatalrdaglpvrdvsdltgfpemlg
grvktlhpavhagilarnipednadmnkqdfslvrvvvcnlypfvktvsspgvtvpeave
kidiggvallraaaknharvtvvcdpadyssvakemaaskdkdtsvetrrhlalkaftht
aqydaaisdyfrkeysk

Timeline for d2iu3a1:

• d2iu3a1 first appeared in SCOPe 2.03
  
• d2iu3a1 appears in SCOPe 2.07