![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
![]() | Species Blue fluorescent Fab 19G2, (mouse), kappa L chain [48906] (1 PDB entry) |
![]() | Domain d1fl3l1: 1fl3 L:2-113 [20485] Other proteins in same PDB: d1fl3a2, d1fl3b2, d1fl3h2, d1fl3l2 |
PDB Entry: 1fl3 (more details), 2.45 Å
SCOP Domain Sequences for d1fl3l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fl3l1 b.1.1.1 (L:2-113) Immunoglobulin (variable domains of L and H chains) {Blue fluorescent Fab 19G2, (mouse), kappa L chain} aaltqspvsnpvtlgtsasiscrstksllhsngitylywylqkpgqspqlliyqmsnlas gvpnrfsssgsgtdftlrintveaedvgvyycaqnlelpptfgagtklelkr
Timeline for d1fl3l1: