SCOPe 2.06: Domain d2is8a_: 2is8 A:

Lineage for d2is8a_ (2is8 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.0: automated matches [191349] (1 protein)
   not a true family

6. Protein automated matches [190284] (9 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225367] (2 PDB entries)

8. Domain d2is8a_: 2is8 A: [204849]
   automated match to d3k6af_
   complexed with fmt

Details for d2is8a_

PDB Entry: 2is8, 1.64 Å

PDB Description: Crystal structure of the Molybdopterin biosynthesis enzyme MoaB (TTHA0341) from thermus theromophilus HB8

PDB Compounds: (A:) Molybdopterin biosynthesis enzyme, MoaB

SCOPe Domain Sequences for d2is8a_:

Sequence; same for both SEQRES and ATOM records:

>d2is8a_ c.57.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mfrvgiltvsdkgfrgerqdtthlairevlaggpfevaayelvpdeppmikkvlrlwadr
egldliltnggtglaprdrtpeatrelldrevpglaelmrlvglrktpmaalsrgvagvr
grtlilnlpgspkgaresleavlpvlphalslvtgkpwk

Timeline for d2is8a_:

• d2is8a_ first appeared in SCOPe 2.03
  
• d2is8a_ appears in SCOPe 2.05
  
• d2is8a_ appears in SCOPe 2.07
  
• d2is8a_ appears in the current release, SCOPe 2.08