![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
![]() | Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) ![]() |
![]() | Family c.57.1.0: automated matches [191349] (1 protein) not a true family |
![]() | Protein automated matches [190284] (9 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [225367] (2 PDB entries) |
![]() | Domain d2is8a_: 2is8 A: [204849] automated match to d3k6af_ complexed with fmt |
PDB Entry: 2is8 (more details), 1.64 Å
SCOPe Domain Sequences for d2is8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2is8a_ c.57.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mfrvgiltvsdkgfrgerqdtthlairevlaggpfevaayelvpdeppmikkvlrlwadr egldliltnggtglaprdrtpeatrelldrevpglaelmrlvglrktpmaalsrgvagvr grtlilnlpgspkgaresleavlpvlphalslvtgkpwk
Timeline for d2is8a_: