SCOPe 2.05: Domain d2irpa_: 2irp A:

Lineage for d2irpa_ (2irp A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
   3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5

4. Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families)

5. Family c.74.1.0: automated matches [227217] (1 protein)
   not a true family

6. Protein automated matches [226955] (2 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [225366] (1 PDB entry)

8. Domain d2irpa_: 2irp A: [204847]
   automated match to d1pvta_
   complexed with bme, cl

Details for d2irpa_

PDB Entry: 2irp, 2.4 Å

PDB Description: Crystal structure of the l-fuculose-1-phosphate aldolase (aq_1979) from aquifex aeolicus VF5

PDB Compounds: (A:) Putative aldolase class 2 protein aq_1979

SCOPe Domain Sequences for d2irpa_:

Sequence; same for both SEQRES and ATOM records:

>d2irpa_ c.74.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}
nvelfkkfsekveeiieagrilhsrgwvpatsgnisakvseeyiaitasgkhkgkltped
illidyegrpvgggkpsaetllhttvyklfpevnavvhthspnatvisivekkdfveled
yellkafpdihthevkikipifpneqnipllakevenyfktsedkygflirghglytwgr
smeealihtealefifecelkllsfh

Timeline for d2irpa_:

• d2irpa_ first appeared in SCOPe 2.03
  
• d2irpa_ appears in SCOPe 2.04
  
• d2irpa_ appears in SCOPe 2.06
  
• d2irpa_ appears in the current release, SCOPe 2.08