SCOPe 2.08: Domain d2iqal2: 2iqa L:107-213

Lineage for d2iqal2 (2iqa L:107-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d2iqal2: 2iqa L:107-213 [204846]
   Other proteins in same PDB: d2iqaa1, d2iqab_, d2iqah_, d2iqal1
   automated match to d1blna2
   complexed with acm, cl, gol

Details for d2iqal2

PDB Entry: 2iqa, 2 Å

PDB Description: PFA2 FAB fragment, monoclinic apo form

PDB Compounds: (L:) IgG2a Fab fragment PFA2 Kappa light chain

SCOPe Domain Sequences for d2iqal2:

Sequence; same for both SEQRES and ATOM records:

>d2iqal2 b.1.1.2 (L:107-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d2iqal2:

• d2iqal2 first appeared in SCOPe 2.03
  
• d2iqal2 appears in SCOPe 2.07