SCOPe 2.04: Domain d2iq9l2: 2iq9 L:107-213

Lineage for d2iq9l2 (2iq9 L:107-213)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)

8. Domain d2iq9l2: 2iq9 L:107-213 [204842]
   Other proteins in same PDB: d2iq9l1
   automated match to d1blna2
   complexed with acm

Details for d2iq9l2

PDB Entry: 2iq9, 2.3 Å

PDB Description: PFA2 FAB fragment, triclinic apo form

PDB Compounds: (L:) IgG2a Fab fragment PFA2 Kappa light chain

SCOPe Domain Sequences for d2iq9l2:

Sequence; same for both SEQRES and ATOM records:

>d2iq9l2 b.1.1.2 (L:107-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d2iq9l2:

• d2iq9l2 first appeared in SCOPe 2.03
  
• d2iq9l2 appears in SCOPe 2.05
  
• d2iq9l2 appears in the current release, SCOPe 2.08