SCOP 1.65: Domain d1fl3h1: 1fl3 H:2-116

Lineage for d1fl3h1 (1fl3 H:2-116)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species

Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (14 PDB entries)
Domain d1fl3h1: 1fl3 H:2-116 [20484]
Other proteins in same PDB: d1fl3a2, d1fl3b1, d1fl3b2, d1fl3h2, d1fl3l1, d1fl3l2

Details for d1fl3h1

PDB Entry: 1fl3 (more details), 2.45 Å

PDB Description: crystal structure of the blue fluorescent antibody (19g2) in complex with stilbene hapten at 277k

SCOP Domain Sequences for d1fl3h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl3h1 b.1.1.1 (H:2-116) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1}
aallesggglvkpggslklsctasgitfsryimswvrqipekrlewvasissggityypd
svagrftisrdnvrnilylqmsslrsedtalyycargqgrpywgqgtsvtvsa

SCOP Domain Coordinates for d1fl3h1:

Click to download the PDB-style file with coordinates for d1fl3h1.
(The format of our PDB-style files is described here.)

Timeline for d1fl3h1: