SCOPe 2.08: Domain d2iptl1: 2ipt L:1-106A

Lineage for d2iptl1 (2ipt L:1-106A)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d2iptl1: 2ipt L:1-106A [204839]
   Other proteins in same PDB: d2iptl2
   automated match to d1blna1
   complexed with acm

Details for d2iptl1

PDB Entry: 2ipt, 2 Å

PDB Description: PFA1 Fab Fragment

PDB Compounds: (L:) IgG2a Fab fragment Heavy Chain

SCOPe Domain Sequences for d2iptl1:

Sequence; same for both SEQRES and ATOM records:

>d2iptl1 b.1.1.1 (L:1-106A) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpltfgagtkleik

Timeline for d2iptl1:

• d2iptl1 first appeared in SCOPe 2.03
  
• d2iptl1 appears in SCOPe 2.07