Lineage for d2iovd1 (2iov D:1-220)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2508387Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2508388Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2509060Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2509061Protein automated matches [190526] (23 species)
    not a true protein
  7. 2509172Species Echinophyllia sp. [TaxId:301887] [188534] (18 PDB entries)
  8. 2509228Domain d2iovd1: 2iov D:1-220 [204838]
    Other proteins in same PDB: d2iovc2, d2iovd2
    automated match to d2pxwb_

Details for d2iovd1

PDB Entry: 2iov (more details), 1.8 Å

PDB Description: bright-state structure of the reversibly switchable fluorescent protein dronpa
PDB Compounds: (D:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d2iovd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iovd1 d.22.1.0 (D:1-220) automated matches {Echinophyllia sp. [TaxId: 301887]}
msvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttv
fcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirf
dgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykak
kvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselp

SCOPe Domain Coordinates for d2iovd1:

Click to download the PDB-style file with coordinates for d2iovd1.
(The format of our PDB-style files is described here.)

Timeline for d2iovd1: