SCOPe 2.06: Domain d2iora1: 2ior A:1-211

Lineage for d2iora1 (2ior A:1-211)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (14 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [225182] (4 PDB entries)

8. Domain d2iora1: 2ior A:1-211 [204834]
   Other proteins in same PDB: d2iora2
   automated match to d2cgfa_
   complexed with adp, hez, mg

Details for d2iora1

PDB Entry: 2ior, 1.65 Å

PDB Description: Crystal Structure of the N-terminal Domain of HtpG, the Escherichia coli Hsp90, Bound to ADP

PDB Compounds: (A:) Chaperone protein htpG

SCOPe Domain Sequences for d2iora1:

Sequence; same for both SEQRES and ATOM records:

>d2iora1 d.122.1.0 (A:1-211) automated matches {Escherichia coli [TaxId: 562]}
mkgqetrgfqsevkqllhlmihslysnkeiflrelisnasdaadklrfralsnpdlyegd
gelrvrvsfdkdkrtltisdngvgmtrdevidhlgtiaksgtksfleslgsdqakdsqli
gqfgvgfysafivadkvtvrtraagekpengvfwesagegeytvaditkedrgteitlhl
regedeflddwrvrsiiskysdhialpveie

Timeline for d2iora1:

• d2iora1 first appeared in SCOPe 2.03, called d2iora_
  
• d2iora1 was called d2iora_ in SCOPe 2.05
  
• d2iora1 appears in SCOPe 2.07
  
• d2iora1 appears in the current release, SCOPe 2.08