Lineage for d1emth1 (1emt H:1-116)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 218987Species Anti-C60 fullerene Fab, (mouse), kappa L chain [48905] (1 PDB entry)
  8. 218988Domain d1emth1: 1emt H:1-116 [20483]
    Other proteins in same PDB: d1emth2, d1emtl2

Details for d1emth1

PDB Entry: 1emt (more details), 2.25 Å

PDB Description: fab antibody fragment of an c60 antifullerene antibody

SCOP Domain Sequences for d1emth1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1emth1 b.1.1.1 (H:1-116) Immunoglobulin (variable domains of L and H chains) {Anti-C60 fullerene Fab, (mouse), kappa L chain}
qvhlqesgpelvrpgasvkiscktsgyvfssswmnwvkqrpgqglkwigriypgngntny
nekfkgkatltadkssntaymqlssltsvdsavyfcatssaywgqgtlltvsa

SCOP Domain Coordinates for d1emth1:

Click to download the PDB-style file with coordinates for d1emth1.
(The format of our PDB-style files is described here.)

Timeline for d1emth1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1emth2