Lineage for d2imsa_ (2ims A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2626588Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2626682Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2627094Family f.1.4.0: automated matches [195065] (1 protein)
    not a true family
  6. 2627095Protein automated matches [195066] (5 species)
    not a true protein
  7. 2627101Species Human (Homo sapiens) [TaxId:9606] [225196] (14 PDB entries)
  8. 2627106Domain d2imsa_: 2ims A: [204827]
    automated match to d4aq3b_
    complexed with zn

Details for d2imsa_

PDB Entry: 2ims (more details), 1.48 Å

PDB Description: the x-ray structure of a bak homodimer reveals an inhibitory zinc binding site
PDB Compounds: (A:) Apoptosis regulator BAK

SCOPe Domain Sequences for d2imsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2imsa_ f.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpsaseeqvaqdteevfrsyvfyrhqqeqeaegvaapadpemvtlplqpsstmgqvgrql
aiigddinrrydsefqtmlqhlqptaenayeyftkiatslfesginwgrvvallgfgyrl
alhvyqhgltgflgqvtrfvvdfmlhhciarwiaqrggwvaal

SCOPe Domain Coordinates for d2imsa_:

Click to download the PDB-style file with coordinates for d2imsa_.
(The format of our PDB-style files is described here.)

Timeline for d2imsa_: