Lineage for d2imka2 (2imk A:87-221)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1736416Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1736417Protein automated matches [226831] (51 species)
    not a true protein
  7. 1736418Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [225348] (4 PDB entries)
  8. 1736421Domain d2imka2: 2imk A:87-221 [204824]
    Other proteins in same PDB: d2imka1, d2imkb1
    automated match to d1pn9a1
    complexed with gtx

Details for d2imka2

PDB Entry: 2imk (more details), 1.9 Å

PDB Description: structures of an insect epsilon-class glutathione s-transferase from the malaria vector anopheles gambiae: evidence for high ddt- detoxifying activity
PDB Compounds: (A:) Epsilon-class Glutathione S-transferase

SCOPe Domain Sequences for d2imka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2imka2 a.45.1.0 (A:87-221) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
pkdpvkqarvnsalhfesgvlfarmrfiferilffgksdipedrveyvqksyelledtlv
ddfvagptmtiadfscistissimgvvpleqskhpriyawidrlkqlpyyeeanggggtd
lgkfvlakkeenaka

SCOPe Domain Coordinates for d2imka2:

Click to download the PDB-style file with coordinates for d2imka2.
(The format of our PDB-style files is described here.)

Timeline for d2imka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2imka1