Lineage for d2imib2 (2imi B:87-220)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2713797Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [225348] (4 PDB entries)
  8. 2713799Domain d2imib2: 2imi B:87-220 [204822]
    Other proteins in same PDB: d2imia1, d2imib1
    automated match to d1pn9a1
    complexed with gsh

Details for d2imib2

PDB Entry: 2imi (more details), 1.4 Å

PDB Description: structures of an insect epsilon-class glutathione s-transferase from the malaria vector anopheles gambiae: evidence for high ddt- detoxifying activity
PDB Compounds: (B:) Epsilon-class Glutathione S-transferase

SCOPe Domain Sequences for d2imib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2imib2 a.45.1.0 (B:87-220) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
pkdpvkqarvnsalhfesgvlfarmrfiferilffgksdipedrveyvqksyelledtlv
ddfvagptmtiadfscistissimgvvpleqskhpriyawidrlkqlpyyeeanggggtd
lgkfvlakkeenak

SCOPe Domain Coordinates for d2imib2:

Click to download the PDB-style file with coordinates for d2imib2.
(The format of our PDB-style files is described here.)

Timeline for d2imib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2imib1