SCOPe 2.08: Domain d2imib1: 2imi B:1-86

Lineage for d2imib1 (2imi B:1-86)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [225347] (4 PDB entries)

8. Domain d2imib1: 2imi B:1-86 [204821]
   Other proteins in same PDB: d2imia2, d2imib2
   automated match to d1pn9a2
   complexed with gsh

Details for d2imib1

PDB Entry: 2imi, 1.4 Å

PDB Description: structures of an insect epsilon-class glutathione s-transferase from the malaria vector anopheles gambiae: evidence for high ddt- detoxifying activity

PDB Compounds: (B:) Epsilon-class Glutathione S-transferase

SCOPe Domain Sequences for d2imib1:

Sequence; same for both SEQRES and ATOM records:

>d2imib1 c.47.1.0 (B:1-86) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
msnlvlytlhlsppcraveltakalgleleqktinlltgdhlkpefvklnpqhtipvldd
ngtiiteshaimiylvtkygkddsly

Timeline for d2imib1:

• d2imib1 first appeared in SCOPe 2.03
  
• d2imib1 appears in SCOPe 2.07