SCOPe 2.07: Domain d2imia2: 2imi A:87-221

Lineage for d2imia2 (2imi A:87-221)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (71 species)
   not a true protein

7. Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [225348] (4 PDB entries)

8. Domain d2imia2: 2imi A:87-221 [204820]
   Other proteins in same PDB: d2imia1, d2imib1
   automated match to d1pn9a1
   complexed with gsh

Details for d2imia2

PDB Entry: 2imi, 1.4 Å

PDB Description: structures of an insect epsilon-class glutathione s-transferase from the malaria vector anopheles gambiae: evidence for high ddt- detoxifying activity

PDB Compounds: (A:) Epsilon-class Glutathione S-transferase

SCOPe Domain Sequences for d2imia2:

Sequence; same for both SEQRES and ATOM records:

>d2imia2 a.45.1.0 (A:87-221) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
pkdpvkqarvnsalhfesgvlfarmrfiferilffgksdipedrveyvqksyelledtlv
ddfvagptmtiadfscistissimgvvpleqskhpriyawidrlkqlpyyeeanggggtd
lgkfvlakkeenaka

Timeline for d2imia2:

• d2imia2 first appeared in SCOPe 2.03
  
• d2imia2 appears in SCOPe 2.06
  
• d2imia2 appears in the current release, SCOPe 2.08