| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
| Protein automated matches [226831] (36 species) not a true protein |
| Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [225348] (4 PDB entries) |
| Domain d2imia2: 2imi A:87-221 [204820] Other proteins in same PDB: d2imia1, d2imib1 automated match to d1pn9a1 complexed with gsh |
PDB Entry: 2imi (more details), 1.4 Å
SCOPe Domain Sequences for d2imia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2imia2 a.45.1.0 (A:87-221) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
pkdpvkqarvnsalhfesgvlfarmrfiferilffgksdipedrveyvqksyelledtlv
ddfvagptmtiadfscistissimgvvpleqskhpriyawidrlkqlpyyeeanggggtd
lgkfvlakkeenaka
Timeline for d2imia2: