SCOP 1.73: Domain d1emtl1: 1emt L:1-107

Lineage for d1emtl1 (1emt L:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)

8. Domain d1emtl1: 1emt L:1-107 [20482]
   Other proteins in same PDB: d1emth1, d1emth2, d1emtl2
   part of anti-C60 fullerene Fab

Details for d1emtl1

PDB Entry: 1emt, 2.25 Å

PDB Description: fab antibody fragment of an c60 antifullerene antibody

PDB Compounds: (L:) igg antibody (light chain)

SCOP Domain Sequences for d1emtl1:

Sequence; same for both SEQRES and ATOM records:

>d1emtl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
diqmtqttsslsaslgdrvtfscsasqdisnylnwyqqkpdgtiklliyytsslrsgvps
rfsgsgsgtdysltinnlepediatyfcqqysrlpftfgsgtkleik

Timeline for d1emtl1:

• d1emtl1 first appeared (with stable ids) in SCOP 1.55
  
• d1emtl1 appears in SCOP 1.71
  
• d1emtl1 appears in SCOP 1.75
  
• d1emtl1 appears in the current release, SCOPe 2.08