SCOPe 2.04: Domain d2im5d2: 2im5 D:138-391

Lineage for d2im5d2 (2im5 D:138-391)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families)
   incomplete beta/alpha barrel with parallel beta-sheet of 7 strands

5. Family c.1.17.2: Monomeric nicotinate phosphoribosyltransferase C-terminal domain [110910] (1 protein)
   automatically mapped to Pfam PF04095

6. Protein Nicotinate phosphoribosyltransferase, C-terminal domain [110911] (4 species)

7. Species Porphyromonas gingivalis [TaxId:837] [225160] (1 PDB entry)

8. Domain d2im5d2: 2im5 D:138-391 [204818]
   Other proteins in same PDB: d2im5a1, d2im5b1, d2im5c1, d2im5d1
   automated match to d1vlpa2

Details for d2im5d2

PDB Entry: 2im5, 2.2 Å

PDB Description: crystal structure of nicotinate phosphoribosyltransferase from porphyromonas gingivalis

PDB Compounds: (D:) Nicotinate phosphoribosyltransferase

SCOPe Domain Sequences for d2im5d2:

Sequence; same for both SEQRES and ATOM records:

>d2im5d2 c.1.17.2 (D:138-391) Nicotinate phosphoribosyltransferase, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]}
epdwkqveevtrskgelmrehratfsifgmrrrfslevedrvtdilkqyageslfgtsnv
hlahkhglrvsgthphewiqfhgaiygykmanyvamedwinvydgdlgtvltdtyttdvf
mrnfskkhamlftslrhdsgdpeifiekavrryeelrvdpkikyiifsdsltpqraieiq
klcagrikasfgigtnltndvgggveplnivmklwkckmtakddwhycvklsdvdgkhtg
epeeillamntlgi

Timeline for d2im5d2:

• d2im5d2 first appeared in SCOPe 2.03
  
• d2im5d2 appears in SCOPe 2.05
  
• d2im5d2 appears in the current release, SCOPe 2.08