Lineage for d2im5d2 (2im5 D:138-391)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089241Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 2089293Family c.1.17.2: Monomeric nicotinate phosphoribosyltransferase C-terminal domain [110910] (1 protein)
    automatically mapped to Pfam PF04095
  6. 2089294Protein Nicotinate phosphoribosyltransferase, C-terminal domain [110911] (4 species)
  7. 2089303Species Porphyromonas gingivalis [TaxId:837] [225160] (1 PDB entry)
  8. 2089307Domain d2im5d2: 2im5 D:138-391 [204818]
    Other proteins in same PDB: d2im5a1, d2im5b1, d2im5c1, d2im5d1
    automated match to d1vlpa2

Details for d2im5d2

PDB Entry: 2im5 (more details), 2.2 Å

PDB Description: Crystal structure of Nicotinate phosphoribosyltransferase from Porphyromonas Gingivalis
PDB Compounds: (D:) Nicotinate phosphoribosyltransferase

SCOPe Domain Sequences for d2im5d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2im5d2 c.1.17.2 (D:138-391) Nicotinate phosphoribosyltransferase, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]}
epdwkqveevtrskgelmrehratfsifgmrrrfslevedrvtdilkqyageslfgtsnv
hlahkhglrvsgthphewiqfhgaiygykmanyvamedwinvydgdlgtvltdtyttdvf
mrnfskkhamlftslrhdsgdpeifiekavrryeelrvdpkikyiifsdsltpqraieiq
klcagrikasfgigtnltndvgggveplnivmklwkckmtakddwhycvklsdvdgkhtg
epeeillamntlgi

SCOPe Domain Coordinates for d2im5d2:

Click to download the PDB-style file with coordinates for d2im5d2.
(The format of our PDB-style files is described here.)

Timeline for d2im5d2: