Lineage for d2im5c2 (2im5 C:138-391)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839614Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 2839666Family c.1.17.2: Nicotinate phosphoribosyltransferase C-terminal domain-like [110910] (2 proteins)
    automatically mapped to Pfam PF04095
  6. 2839667Protein Nicotinate phosphoribosyltransferase, C-terminal domain [110911] (5 species)
  7. 2839681Species Porphyromonas gingivalis [TaxId:837] [225160] (1 PDB entry)
  8. 2839684Domain d2im5c2: 2im5 C:138-391 [204816]
    Other proteins in same PDB: d2im5a1, d2im5b1, d2im5c1, d2im5d1
    automated match to d1vlpa2

Details for d2im5c2

PDB Entry: 2im5 (more details), 2.2 Å

PDB Description: crystal structure of nicotinate phosphoribosyltransferase from porphyromonas gingivalis
PDB Compounds: (C:) Nicotinate phosphoribosyltransferase

SCOPe Domain Sequences for d2im5c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2im5c2 c.1.17.2 (C:138-391) Nicotinate phosphoribosyltransferase, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]}
epdwkqveevtrskgelmrehratfsifgmrrrfslevedrvtdilkqyageslfgtsnv
hlahkhglrvsgthphewiqfhgaiygykmanyvamedwinvydgdlgtvltdtyttdvf
mrnfskkhamlftslrhdsgdpeifiekavrryeelrvdpkikyiifsdsltpqraieiq
klcagrikasfgigtnltndvgggveplnivmklwkckmtakddwhycvklsdvdgkhtg
epeeillamntlgi

SCOPe Domain Coordinates for d2im5c2:

Click to download the PDB-style file with coordinates for d2im5c2.
(The format of our PDB-style files is described here.)

Timeline for d2im5c2: