![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
![]() | Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (4 families) ![]() |
![]() | Family d.41.2.2: Monomeric nicotinate phosphoribosyltransferase N-terminal domain-like [110907] (1 protein) |
![]() | Protein Nicotinate phosphoribosyltransferase, N-terminal domain [110908] (4 species) |
![]() | Species Porphyromonas gingivalis [TaxId:837] [225159] (1 PDB entry) |
![]() | Domain d2im5b1: 2im5 B:3-137 [204813] Other proteins in same PDB: d2im5a2, d2im5b2, d2im5c2, d2im5d2 automated match to d1vlpa1 |
PDB Entry: 2im5 (more details), 2.2 Å
SCOPe Domain Sequences for d2im5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2im5b1 d.41.2.2 (B:3-137) Nicotinate phosphoribosyltransferase, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} iirsildtdlykfttgyayaklfpraygefrfidrnrqgfteefaelvrgeiramaalsl trdekeflqrelpylppiyidfldgfrfdpeevtvsidaqghldiraqgllyrvtlwetp ilaviselyyrfiga
Timeline for d2im5b1: