SCOPe 2.06: Domain d2il3b2: 2il3 B:87-218

Lineage for d2il3b2 (2il3 B:87-218)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (61 species)
   not a true protein

7. Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [225348] (4 PDB entries)

8. Domain d2il3b2: 2il3 B:87-218 [204810]
   Other proteins in same PDB: d2il3a1, d2il3b1
   automated match to d1pn9a1

Details for d2il3b2

PDB Entry: 2il3, 2.2 Å

PDB Description: structures of an insect epsilon-class glutathione s-transferase from the malaria vector anopheles gambiae: evidence for high ddt- detoxifying activity

PDB Compounds: (B:) Epsilon-class Glutathione S-transferase

SCOPe Domain Sequences for d2il3b2:

Sequence; same for both SEQRES and ATOM records:

>d2il3b2 a.45.1.0 (B:87-218) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
pkdpvkqarvnsalhfesgvlfarmrfiferilffgksdipedrveyvqksyelledtlv
ddfvagptmtiadfscistissimgvvpleqskhpriyawidrlkqlpyyeeanggggtd
lgkfvlakkeen

Timeline for d2il3b2:

• d2il3b2 first appeared in SCOPe 2.03
  
• d2il3b2 appears in SCOPe 2.05
  
• d2il3b2 appears in SCOPe 2.07
  
• d2il3b2 appears in the current release, SCOPe 2.08