Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (61 species) not a true protein |
Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [225348] (4 PDB entries) |
Domain d2il3b2: 2il3 B:87-218 [204810] Other proteins in same PDB: d2il3a1, d2il3b1 automated match to d1pn9a1 |
PDB Entry: 2il3 (more details), 2.2 Å
SCOPe Domain Sequences for d2il3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2il3b2 a.45.1.0 (B:87-218) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]} pkdpvkqarvnsalhfesgvlfarmrfiferilffgksdipedrveyvqksyelledtlv ddfvagptmtiadfscistissimgvvpleqskhpriyawidrlkqlpyyeeanggggtd lgkfvlakkeen
Timeline for d2il3b2: