Lineage for d1etzb1 (1etz B:1-126)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511260Species Mouse (Mus musculus), cluster 6 [TaxId:10090] [88556] (12 PDB entries)
    SQ NA # part of Fab 28 against HIV-1 RT
  8. 1511261Domain d1etzb1: 1etz B:1-126 [20481]
    Other proteins in same PDB: d1etza1, d1etza2, d1etzb2, d1etzh2, d1etzl1, d1etzl2
    part of anti-sweetener Fab NC10.14
    complexed with gas

Details for d1etzb1

PDB Entry: 1etz (more details), 2.6 Å

PDB Description: the three-dimensional structure of an anti-sweetener fab, nc10.14, shows the extent of structural diversity in antigen recognition by immunoglobulins
PDB Compounds: (B:) fab nc10.14 - heavy chain

SCOPe Domain Sequences for d1etzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]}
qvtlkesgpgilqpsqtlsltcsfsgfslstsgmgvgwirqpsgeglewladiwwndkky
ynpslksrltvskdtssnqvflkitsvdtsdtatyhcarrtfsyyygssfyyfdnwgqgt
tltvss

SCOPe Domain Coordinates for d1etzb1:

Click to download the PDB-style file with coordinates for d1etzb1.
(The format of our PDB-style files is described here.)

Timeline for d1etzb1: