SCOP 1.63: Domain d1etzb1: 1etz B:1-126

Lineage for d1etzb1 (1etz B:1-126)

Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
Species Anti-sweetener Fab NC10.14, (mouse), lamba L chain [48904] (1 PDB entry)
Domain d1etzb1: 1etz B:1-126 [20481]
Other proteins in same PDB: d1etza2, d1etzb2, d1etzh2, d1etzl2
complexed with gas

Details for d1etzb1

PDB Entry: 1etz (more details), 2.6 Å

PDB Description: the three-dimensional structure of an anti-sweetener fab, nc10.14, shows the extent of structural diversity in antigen recognition by immunoglobulins

SCOP Domain Sequences for d1etzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin (variable domains of L and H chains) {Anti-sweetener Fab NC10.14, (mouse), lamba L chain}
qvtlkesgpgilqpsqtlsltcsfsgfslstsgmgvgwirqpsgeglewladiwwndkky
ynpslksrltvskdtssnqvflkitsvdtsdtatyhcarrtfsyyygssfyyfdnwgqgt
tltvss

SCOP Domain Coordinates for d1etzb1:

Click to download the PDB-style file with coordinates for d1etzb1.
(The format of our PDB-style files is described here.)

Timeline for d1etzb1: