Lineage for d2il1a_ (2il1 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1849890Species Human (Homo sapiens) [TaxId:9606] [186862] (102 PDB entries)
  8. 1849962Domain d2il1a_: 2il1 A: [204806]
    automated match to d2gf9a_
    complexed with ca, gdp, mg, unx

Details for d2il1a_

PDB Entry: 2il1 (more details), 2.1 Å

PDB Description: crystal structure of a predicted human gtpase in complex with gdp
PDB Compounds: (A:) Rab12

SCOPe Domain Sequences for d2il1a_:

Sequence, based on SEQRES records: (download)

>d2il1a_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
padfklqviiigsrgvgktslmerftddtfceackstvgvdfkiktvelrgkkirlqiwd
tagqerfnsitsayyrsakgiilvyditkketfddlpkwmkmidkyasedaelllvgnkl
dcetdreitrqqgekfaqqitgmrfceasakdnfnvdeiflklvddilkkm

Sequence, based on observed residues (ATOM records): (download)

>d2il1a_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
padfklqviiigsrgvgktslmerftdstvgvdfkiktvelrgkkirlqiwdtagqerfn
sitsayyrsakgiilvyditkketfddlpkwmkmidkyasedaelllvgnkldcetdrei
trqqgekfaqqitgmrfceasakdnfnvdeiflklvddilkkm

SCOPe Domain Coordinates for d2il1a_:

Click to download the PDB-style file with coordinates for d2il1a_.
(The format of our PDB-style files is described here.)

Timeline for d2il1a_: