Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
Protein automated matches [190646] (60 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [225166] (3 PDB entries) |
Domain d2iksa_: 2iks A: [204804] automated match to d1dbqa_ |
PDB Entry: 2iks (more details), 1.85 Å
SCOPe Domain Sequences for d2iksa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iksa_ c.93.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} grtrsiglvipdlentsytrianylerqarqrgyqlliacsedqpdnemrciehllqrqv daiivstslppehpfyqrwandpfpivaldraldrehftsvvgadqddaemlaeelrkfp aetvlylgalpelsvsflreqgfrtawkddprevhflyansyereaaaqlfekwlethpm pqalfttsfallqgvmdvtlrrdgklpsdlaiatfgdnelldflqcpvlavaqrhrdvae rvleivlasldeprkpkpgltrikrnlyrrgvlsrs
Timeline for d2iksa_: