Lineage for d2iksa_ (2iks A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1878506Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1878507Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1878777Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 1878778Protein automated matches [190646] (60 species)
    not a true protein
  7. 1878902Species Escherichia coli K-12 [TaxId:83333] [225166] (3 PDB entries)
  8. 1878903Domain d2iksa_: 2iks A: [204804]
    automated match to d1dbqa_

Details for d2iksa_

PDB Entry: 2iks (more details), 1.85 Å

PDB Description: Crystal structure of N-terminal truncated DNA-binding transcriptional dual regulator from Escherichia coli K12
PDB Compounds: (A:) DNA-binding transcriptional dual regulator

SCOPe Domain Sequences for d2iksa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iksa_ c.93.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
grtrsiglvipdlentsytrianylerqarqrgyqlliacsedqpdnemrciehllqrqv
daiivstslppehpfyqrwandpfpivaldraldrehftsvvgadqddaemlaeelrkfp
aetvlylgalpelsvsflreqgfrtawkddprevhflyansyereaaaqlfekwlethpm
pqalfttsfallqgvmdvtlrrdgklpsdlaiatfgdnelldflqcpvlavaqrhrdvae
rvleivlasldeprkpkpgltrikrnlyrrgvlsrs

SCOPe Domain Coordinates for d2iksa_:

Click to download the PDB-style file with coordinates for d2iksa_.
(The format of our PDB-style files is described here.)

Timeline for d2iksa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2iksb_