Lineage for d2iipb1 (2iip B:1-260)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (64 species)
    not a true protein
  7. 2130730Species Human (Homo sapiens) [TaxId:9606] [187871] (15 PDB entries)
  8. 2130745Domain d2iipb1: 2iip B:1-260 [204793]
    Other proteins in same PDB: d2iipa2, d2iipb2
    automated match to d2i62b_
    complexed with sah

Details for d2iipb1

PDB Entry: 2iip (more details), 2.05 Å

PDB Description: Human Nicotinamide N-methyltransferase
PDB Compounds: (B:) Nicotinamide N-methyltransferase

SCOPe Domain Sequences for d2iipb1:

Sequence, based on SEQRES records: (download)

>d2iipb1 c.66.1.0 (B:1-260) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mesgftskdtylshfnprdylekyykfgsrhsaesqilkhllknlfkifcldgvkgdlli
digsgptiyqllsacesfkeivvtdysdqnlqelekwlkaapaafdwspvvtyvcdlegn
rvkgpekeeklrqavkqvlkcdvtqsqplgavplppadcvlstlcldaacpdlptycral
rnlgsllkpggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisq
sysstmanneglfslvarkl

Sequence, based on observed residues (ATOM records): (download)

>d2iipb1 c.66.1.0 (B:1-260) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mesgftskdtylshfnprdylekyyksaesqilkhllknlfkifcldgvkgdllidigsg
ptiyqllsacesfkeivvtdysdqnlqelekwlkaapaafdwspvvtyvcdlegnrvkgp
ekeeklrqavkqvlkcdvtqsqplgavplppadcvlstlcldaacpdlptycralrnlgs
llkpggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisqsysst
manneglfslvarkl

SCOPe Domain Coordinates for d2iipb1:

Click to download the PDB-style file with coordinates for d2iipb1.
(The format of our PDB-style files is described here.)

Timeline for d2iipb1: