![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (87 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187871] (37 PDB entries) |
![]() | Domain d2iipa1: 2iip A:-8-260 [204792] Other proteins in same PDB: d2iipa2, d2iipb2 automated match to d2i62b_ complexed with sah |
PDB Entry: 2iip (more details), 2.05 Å
SCOPe Domain Sequences for d2iipa1:
Sequence, based on SEQRES records: (download)
>d2iipa1 c.66.1.0 (A:-8-260) automated matches {Human (Homo sapiens) [TaxId: 9606]} ssglvprgsmesgftskdtylshfnprdylekyykfgsrhsaesqilkhllknlfkifcl dgvkgdllidigsgptiyqllsacesfkeivvtdysdqnlqelekwlkaapaafdwspvv tyvcdlegnrvkgpekeeklrqavkqvlkcdvtqsqplgavplppadcvlstlcldaacp dlptycralrnlgsllkpggflvimdalkssyymigeqkfsslplgreaveaavkeagyt iewfevisqsysstmanneglfslvarkl
>d2iipa1 c.66.1.0 (A:-8-260) automated matches {Human (Homo sapiens) [TaxId: 9606]} ssglvprgsmesgftskdtylshfnprdylekyyksaesqilkhllknlfkifcldgvkg dllidigsgptiyqllsacesfkeivvtdysdqnlqelekwlkaapaafdwspvvtyvcd legnrvkgpekeeklrqavkqvlkcdvtqsqplgavplppadcvlstlcldaacpdlpty cralrnlgsllkpggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfe visqsysstmanneglfslvarkl
Timeline for d2iipa1:
![]() Domains from other chains: (mouse over for more information) d2iipb1, d2iipb2, d2iipc_, d2iipd_ |