Lineage for d2iikb2 (2iik B:298-425)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917733Species Human (Homo sapiens) [TaxId:9606] [224964] (6 PDB entries)
  8. 2917747Domain d2iikb2: 2iik B:298-425 [204791]
    Other proteins in same PDB: d2iikb3
    automated match to d1wdkc2

Details for d2iikb2

PDB Entry: 2iik (more details), 2.55 Å

PDB Description: Crystal Structure of human peroxisomal acetyl-CoA acyl transferase 1 (ACAA1)
PDB Compounds: (B:) 3-ketoacyl-CoA thiolase, peroxisomal

SCOPe Domain Sequences for d2iikb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iikb2 c.95.1.0 (B:298-425) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glpilgvlrsyavvgvppdimgigpayaipvalqkagltvsdvdifeineafasqaaycv
eklrlppekvnplggavalghplgctgarqvitllnelkrrgkraygvvsmcigtgmgaa
avfeypgn

SCOPe Domain Coordinates for d2iikb2:

Click to download the PDB-style file with coordinates for d2iikb2.
(The format of our PDB-style files is described here.)

Timeline for d2iikb2: