Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Mouse (Mus musculus), cluster 6 [TaxId:10090] [88556] (12 PDB entries) SQ NA # part of Fab 28 against HIV-1 RT |
Domain d1etzh1: 1etz H:1-126 [20479] Other proteins in same PDB: d1etza1, d1etza2, d1etzb2, d1etzh2, d1etzl1, d1etzl2 part of anti-sweetener Fab NC10.14 complexed with gas |
PDB Entry: 1etz (more details), 2.6 Å
SCOPe Domain Sequences for d1etzh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1etzh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} qvtlkesgpgilqpsqtlsltcsfsgfslstsgmgvgwirqpsgeglewladiwwndkky ynpslksrltvskdtssnqvflkitsvdtsdtatyhcarrtfsyyygssfyyfdnwgqgt tltvss
Timeline for d1etzh1: