Lineage for d1etzh1 (1etz H:1-126)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740552Species Mouse (Mus musculus), cluster 6 [TaxId:10090] [88556] (12 PDB entries)
    SQ NA # part of Fab 28 against HIV-1 RT
  8. 2740560Domain d1etzh1: 1etz H:1-126 [20479]
    Other proteins in same PDB: d1etza1, d1etza2, d1etzb2, d1etzh2, d1etzl1, d1etzl2
    part of anti-sweetener Fab NC10.14
    complexed with gas

Details for d1etzh1

PDB Entry: 1etz (more details), 2.6 Å

PDB Description: the three-dimensional structure of an anti-sweetener fab, nc10.14, shows the extent of structural diversity in antigen recognition by immunoglobulins
PDB Compounds: (H:) fab nc10.14 - heavy chain

SCOPe Domain Sequences for d1etzh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1etzh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]}
qvtlkesgpgilqpsqtlsltcsfsgfslstsgmgvgwirqpsgeglewladiwwndkky
ynpslksrltvskdtssnqvflkitsvdtsdtatyhcarrtfsyyygssfyyfdnwgqgt
tltvss

SCOPe Domain Coordinates for d1etzh1:

Click to download the PDB-style file with coordinates for d1etzh1.
(The format of our PDB-style files is described here.)

Timeline for d1etzh1: