Lineage for d2iika1 (2iik A:33-297)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2146372Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2146373Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2147118Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2147119Protein automated matches [196909] (58 species)
    not a true protein
  7. 2147372Species Human (Homo sapiens) [TaxId:9606] [224964] (6 PDB entries)
  8. 2147387Domain d2iika1: 2iik A:33-297 [204788]
    Other proteins in same PDB: d2iikb3
    automated match to d1wdkc1

Details for d2iika1

PDB Entry: 2iik (more details), 2.55 Å

PDB Description: Crystal Structure of human peroxisomal acetyl-CoA acyl transferase 1 (ACAA1)
PDB Compounds: (A:) 3-ketoacyl-CoA thiolase, peroxisomal

SCOPe Domain Sequences for d2iika1:

Sequence, based on SEQRES records: (download)

>d2iika1 c.95.1.0 (A:33-297) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asaadvvvvhgrrtaicragrggfkdttpdellsavmtavlkdvnlrpeqlgdicvgnvl
qpgagaimariaqflsdipetvplstvnrqcssglqavasiaggirngsydigmacgves
msladrgnpgnitsrlmekekardclipmgitsenvaerfgisrekqdtfalasqqkaar
aqskgcfqaeivpvtttvhddkgtkrsitvtqdegirpsttmeglaklkpafkkdgstta
gnssqvsdgaaaillarrskaeel

Sequence, based on observed residues (ATOM records): (download)

>d2iika1 c.95.1.0 (A:33-297) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asaadvvvvhgrrtaicragrggfkdttpdellsavmtavlkdvnlrpeqlgdicvgnvl
qpgagaimariaqflsdipetvplstvnrqcssglqavasiaggirngsydigmacgves
msladgnitsrlmekekardclipmgitsenvaerfgisrekqdtfalasqqkaaraqsk
gcfqaeivpvtttvhddkgtkrsitvtqdegirpsttmeglaklkpafkkdgsttagnss
qvsdgaaaillarrskaeel

SCOPe Domain Coordinates for d2iika1:

Click to download the PDB-style file with coordinates for d2iika1.
(The format of our PDB-style files is described here.)

Timeline for d2iika1: