Lineage for d2ihda_ (2ihd A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1275178Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 1275179Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 1275237Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 1275238Protein automated matches [190464] (2 species)
    not a true protein
  7. 1275242Species Human (Homo sapiens) [TaxId:9606] [187381] (10 PDB entries)
  8. 1275243Domain d2ihda_: 2ihd A: [204787]
    automated match to d2a72a_
    complexed with cl

Details for d2ihda_

PDB Entry: 2ihd (more details), 1.7 Å

PDB Description: Crystal structure of Human Regulator of G-protein signaling 8, RGS8
PDB Compounds: (A:) Regulator of G-protein signaling 8

SCOPe Domain Sequences for d2ihda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ihda_ a.91.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
steeatrwadsfdvllshkygvaafraflktefseenlefwlaceefkktrstaklvska
hrifeefvdvqaprevnidfqtreatrknlqepsltcfdqaqgkvhslmekdsyprflrs
kmyldll

SCOPe Domain Coordinates for d2ihda_:

Click to download the PDB-style file with coordinates for d2ihda_.
(The format of our PDB-style files is described here.)

Timeline for d2ihda_: