| Root: SCOPe 2.03 |
| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) ![]() |
| Family a.91.1.0: automated matches [191379] (1 protein) not a true family |
| Protein automated matches [190464] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187381] (10 PDB entries) |
| Domain d2ihda_: 2ihd A: [204787] automated match to d2a72a_ complexed with cl |
PDB Entry: 2ihd (more details), 1.7 Å
SCOPe Domain Sequences for d2ihda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ihda_ a.91.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
steeatrwadsfdvllshkygvaafraflktefseenlefwlaceefkktrstaklvska
hrifeefvdvqaprevnidfqtreatrknlqepsltcfdqaqgkvhslmekdsyprflrs
kmyldll
Timeline for d2ihda_: