Lineage for d2ih3c_ (2ih3 C:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252668Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2252669Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
  5. 2252670Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2252691Protein Potassium channel protein [56901] (2 species)
  7. 2252736Species Streptomyces lividans [TaxId:1916] [161074] (20 PDB entries)
  8. 2252737Domain d2ih3c_: 2ih3 C: [204786]
    Other proteins in same PDB: d2ih3a1, d2ih3a2, d2ih3b1, d2ih3b2
    automated match to d1s5hc_
    complexed with 1em, k

Details for d2ih3c_

PDB Entry: 2ih3 (more details), 1.72 Å

PDB Description: Ion selectivity in a semi-synthetic K+ channel locked in the conductive conformation
PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2ih3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ih3c_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
lhwraagaatvllvivllagsylavlaergapgaqlitypralwwacetattvaygdlyp
vtlwgrlvavvvmvagitsfglvtaalatwfvgreqer

SCOPe Domain Coordinates for d2ih3c_:

Click to download the PDB-style file with coordinates for d2ih3c_.
(The format of our PDB-style files is described here.)

Timeline for d2ih3c_: