| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88567] (374 PDB entries) Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region |
| Domain d2ih3b2: 2ih3 B:108-212 [204785] Other proteins in same PDB: d2ih3a1, d2ih3a2, d2ih3a3, d2ih3b1, d2ih3c_ automated match to d1r3ja2 complexed with 1em, k |
PDB Entry: 2ih3 (more details), 1.72 Å
SCOPe Domain Sequences for d2ih3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ih3b2 b.1.1.2 (B:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d2ih3b2:
View in 3DDomains from other chains: (mouse over for more information) d2ih3a1, d2ih3a2, d2ih3a3, d2ih3c_ |