| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (9 families) ![]() |
| Family a.118.8.0: automated matches [191581] (1 protein) not a true family |
| Protein automated matches [191037] (12 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225165] (1 PDB entry) |
| Domain d2if4a2: 2if4 A:161-292 [204774] Other proteins in same PDB: d2if4a1 automated match to d1kt1a1 |
PDB Entry: 2if4 (more details), 2.85 Å
SCOPe Domain Sequences for d2if4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2if4a2 a.118.8.0 (A:161-292) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tkegkarsdmtveerigaadrrkmdgnslfkeekleeamqqyemaiaymgddfmfqlygk
yqdmalavknpchlniaacliklkrydeaighcnivlteeeknpkalfrrgkakaelgqm
dsarddfrkaqk
Timeline for d2if4a2: