Lineage for d2if4a2 (2if4 A:161-292)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726989Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2726990Protein automated matches [191037] (12 species)
    not a true protein
  7. 2727045Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225165] (2 PDB entries)
  8. 2727052Domain d2if4a2: 2if4 A:161-292 [204774]
    Other proteins in same PDB: d2if4a1
    automated match to d1kt1a1

Details for d2if4a2

PDB Entry: 2if4 (more details), 2.85 Å

PDB Description: Crystal structure of a multi-domain immunophilin from Arabidopsis thaliana
PDB Compounds: (A:) AtFKBP42

SCOPe Domain Sequences for d2if4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2if4a2 a.118.8.0 (A:161-292) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tkegkarsdmtveerigaadrrkmdgnslfkeekleeamqqyemaiaymgddfmfqlygk
yqdmalavknpchlniaacliklkrydeaighcnivlteeeknpkalfrrgkakaelgqm
dsarddfrkaqk

SCOPe Domain Coordinates for d2if4a2:

Click to download the PDB-style file with coordinates for d2if4a2.
(The format of our PDB-style files is described here.)

Timeline for d2if4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2if4a1