SCOPe 2.07: Domain d2if4a2: 2if4 A:161-292

Lineage for d2if4a2 (2if4 A:161-292)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (10 families)

5. Family a.118.8.0: automated matches [191581] (1 protein)
   not a true family

6. Protein automated matches [191037] (12 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225165] (1 PDB entry)

8. Domain d2if4a2: 2if4 A:161-292 [204774]
   Other proteins in same PDB: d2if4a1
   automated match to d1kt1a1

Details for d2if4a2

PDB Entry: 2if4, 2.85 Å

PDB Description: Crystal structure of a multi-domain immunophilin from Arabidopsis thaliana

PDB Compounds: (A:) AtFKBP42

SCOPe Domain Sequences for d2if4a2:

Sequence; same for both SEQRES and ATOM records:

>d2if4a2 a.118.8.0 (A:161-292) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tkegkarsdmtveerigaadrrkmdgnslfkeekleeamqqyemaiaymgddfmfqlygk
yqdmalavknpchlniaacliklkrydeaighcnivlteeeknpkalfrrgkakaelgqm
dsarddfrkaqk

Timeline for d2if4a2:

• d2if4a2 first appeared in SCOPe 2.03
  
• d2if4a2 appears in SCOPe 2.06