Lineage for d2idca1 (2idc A:2-174)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766651Superfamily b.1.22: ASF1-like [101546] (2 families) (S)
    contains extra C-terminal strand
    automatically mapped to Pfam PF04729
  5. 2766652Family b.1.22.1: ASF1-like [101547] (2 proteins)
  6. 2766678Protein automated matches [195145] (3 species)
    not a true protein
  7. 2766679Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [195164] (3 PDB entries)
  8. 2766681Domain d2idca1: 2idc A:2-174 [204772]
    Other proteins in same PDB: d2idca2
    automated match to d4eo5a_

Details for d2idca1

PDB Entry: 2idc (more details), 2.2 Å

PDB Description: structure of the histone h3-asf1 chaperone interaction
PDB Compounds: (A:) Anti-silencing protein 1 and Histone H3 Chimera

SCOPe Domain Sequences for d2idca1:

Sequence, based on SEQRES records: (download)

>d2idca1 b.1.22.1 (A:2-174) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsil
vgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydeee
lrenppakvqvdhivrnilaekprvtrfnivwdnaagaataakkeiklarrlr

Sequence, based on observed residues (ATOM records): (download)

>d2idca1 b.1.22.1 (A:2-174) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsil
vgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydeee
lrenppakvqvdhivrnilaekprvtrfnivwdnaakeiklarrlr

SCOPe Domain Coordinates for d2idca1:

Click to download the PDB-style file with coordinates for d2idca1.
(The format of our PDB-style files is described here.)

Timeline for d2idca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2idca2