SCOPe 2.08: Domain d2iala2: 2ial A:110-198

Lineage for d2iala2 (2ial A:110-198)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d2iala2: 2ial A:110-198 [204765]
   Other proteins in same PDB: d2iala1, d2ialb1, d2ialc1, d2iald1
   automated match to d1qrnd2
   mutant

Details for d2iala2

PDB Entry: 2ial, 1.92 Å

PDB Description: Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR

PDB Compounds: (A:) CD4+ T cell receptor E8 alpha chain

SCOPe Domain Sequences for d2iala2:

Sequence, based on SEQRES records:

>d2iala2 b.1.1.2 (A:110-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d2iala2 b.1.1.2 (A:110-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsav
awsnksdfacanafnnsiipedtffps

Timeline for d2iala2:

• d2iala2 first appeared in SCOPe 2.03
  
• d2iala2 appears in SCOPe 2.07