Lineage for d2iala2 (2ial A:110-198)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750047Domain d2iala2: 2ial A:110-198 [204765]
    Other proteins in same PDB: d2iala1, d2ialb1, d2ialc1, d2iald1
    automated match to d1qrnd2
    mutant

Details for d2iala2

PDB Entry: 2ial (more details), 1.92 Å

PDB Description: Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR
PDB Compounds: (A:) CD4+ T cell receptor E8 alpha chain

SCOPe Domain Sequences for d2iala2:

Sequence, based on SEQRES records: (download)

>d2iala2 b.1.1.2 (A:110-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d2iala2 b.1.1.2 (A:110-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsav
awsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d2iala2:

Click to download the PDB-style file with coordinates for d2iala2.
(The format of our PDB-style files is described here.)

Timeline for d2iala2: