Lineage for d2ia6a1 (2ia6 A:1-240)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1451898Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1451899Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1453122Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 1453123Protein DinB homolog (DBH) [100889] (3 species)
  7. 1453133Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (58 PDB entries)
  8. 1453173Domain d2ia6a1: 2ia6 A:1-240 [204760]
    Other proteins in same PDB: d2ia6a2, d2ia6b2
    automated match to d1jx4a2
    protein/DNA complex; complexed with atp, bap, ca, edo, gol, po4

Details for d2ia6a1

PDB Entry: 2ia6 (more details), 2.5 Å

PDB Description: Bypass of Major Benzopyrene-dG Adduct by Y-Family DNA Polymerase with Unique Structural Gap
PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d2ia6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ia6a1 e.8.1.7 (A:1-240) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr

SCOPe Domain Coordinates for d2ia6a1:

Click to download the PDB-style file with coordinates for d2ia6a1.
(The format of our PDB-style files is described here.)

Timeline for d2ia6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ia6a2