![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
![]() | Protein automated matches [226851] (46 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries) |
![]() | Domain d2i9pd2: 2i9p D:202-332 [204759] Other proteins in same PDB: d2i9pa1, d2i9pa3, d2i9pb1, d2i9pb3, d2i9pc1, d2i9pc3, d2i9pd1, d2i9pd3 automated match to d2cvza1 complexed with nad |
PDB Entry: 2i9p (more details), 2.55 Å
SCOPe Domain Sequences for d2i9pd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i9pd2 a.100.1.0 (D:202-332) automated matches {Human (Homo sapiens) [TaxId: 9606]} vgtgqaakicnnmllaismigtaeamnlgirlgldpkllakilnmssgrcwssdtynpvp gvmdgvpsannyqggfgttlmakdlglaqdsatstkspillgslahqiyrmmcakgyskk dfssvfqflre
Timeline for d2i9pd2: