![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
![]() | Protein automated matches [226904] (39 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:93062] [225144] (2 PDB entries) |
![]() | Domain d2i8ca2: 2i8c A:129-356 [204751] Other proteins in same PDB: d2i8ca1, d2i8ca3, d2i8cb1, d2i8cb3 automated match to d1ehib2 complexed with adp, mg, so4 |
PDB Entry: 2i8c (more details), 2.46 Å
SCOPe Domain Sequences for d2i8ca2:
Sequence, based on SEQRES records: (download)
>d2i8ca2 d.142.1.0 (A:129-356) automated matches {Staphylococcus aureus [TaxId: 93062]} dklvmkqlfehrglpqlpyisflrseyekyehnilklvndklnypvfvkpanlgssvgis kcnneaelkegikeafqfdrklvieqgvnareievavlgndypeatwpgevvkdvafydy kskykdgkvqlqipadldedvqltlrnmaleafkatdcsglvradffvtednqiyinetn ampgftafsmypklwenmglsypelitklielakerhqdkqknkykid
>d2i8ca2 d.142.1.0 (A:129-356) automated matches {Staphylococcus aureus [TaxId: 93062]} dklvmkqlfehrglpqlpyisflrseyekyehnilklvndklnypvfvkpanlgssvgis kcnneaelkegikeafqfdrklvieqgvnareievavlgndypeatwpgevvkdvafvql qipadldedvqltlrnmaleafkatdcsglvradffvtednqiyinetnampgftafsmy pklwenmglsypelitklielakerhqdkqknkykid
Timeline for d2i8ca2: