Lineage for d2i8ca2 (2i8c A:129-356)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2979068Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2979069Protein automated matches [226904] (39 species)
    not a true protein
  7. 2979206Species Staphylococcus aureus [TaxId:93062] [225144] (2 PDB entries)
  8. 2979209Domain d2i8ca2: 2i8c A:129-356 [204751]
    Other proteins in same PDB: d2i8ca1, d2i8ca3, d2i8cb1, d2i8cb3
    automated match to d1ehib2
    complexed with adp, mg, so4

Details for d2i8ca2

PDB Entry: 2i8c (more details), 2.46 Å

PDB Description: Allosteric inhibition of Staphylococcus aureus D-alanine:D-alanine ligase revealed by crystallographic studies
PDB Compounds: (A:) D-alanine-D-alanine ligase

SCOPe Domain Sequences for d2i8ca2:

Sequence, based on SEQRES records: (download)

>d2i8ca2 d.142.1.0 (A:129-356) automated matches {Staphylococcus aureus [TaxId: 93062]}
dklvmkqlfehrglpqlpyisflrseyekyehnilklvndklnypvfvkpanlgssvgis
kcnneaelkegikeafqfdrklvieqgvnareievavlgndypeatwpgevvkdvafydy
kskykdgkvqlqipadldedvqltlrnmaleafkatdcsglvradffvtednqiyinetn
ampgftafsmypklwenmglsypelitklielakerhqdkqknkykid

Sequence, based on observed residues (ATOM records): (download)

>d2i8ca2 d.142.1.0 (A:129-356) automated matches {Staphylococcus aureus [TaxId: 93062]}
dklvmkqlfehrglpqlpyisflrseyekyehnilklvndklnypvfvkpanlgssvgis
kcnneaelkegikeafqfdrklvieqgvnareievavlgndypeatwpgevvkdvafvql
qipadldedvqltlrnmaleafkatdcsglvradffvtednqiyinetnampgftafsmy
pklwenmglsypelitklielakerhqdkqknkykid

SCOPe Domain Coordinates for d2i8ca2:

Click to download the PDB-style file with coordinates for d2i8ca2.
(The format of our PDB-style files is described here.)

Timeline for d2i8ca2: