SCOPe 2.06: Domain d1c5ch1: 1c5c H:1-113

Lineage for d1c5ch1 (1c5c H:1-113)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (184 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d1c5ch1: 1c5c H:1-113 [20475]
   Other proteins in same PDB: d1c5ch2, d1c5cl1, d1c5cl2
   part of humanized catalytic Fab 21D8 with a decarboxylase activity
   complexed with gol, tk4

Details for d1c5ch1

PDB Entry: 1c5c, 1.61 Å

PDB Description: decarboxylase catalytic antibody 21d8-hapten complex

PDB Compounds: (H:) chimeric decarboxylase antibody 21d8

SCOPe Domain Sequences for d1c5ch1:

Sequence; same for both SEQRES and ATOM records:

>d1c5ch1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqllepgtelvkpgasvklscrasgysftsywmhwvkqrpgqglewiglidpsngrtnf
ndkfksratltvdtssstaymqlssltsedsavyycvriaywgqgtlvtvss

Timeline for d1c5ch1:

• d1c5ch1 first appeared (with stable ids) in SCOP 1.55
  
• d1c5ch1 appears in SCOPe 2.05
  
• d1c5ch1 appears in SCOPe 2.07
  
• d1c5ch1 appears in the current release, SCOPe 2.08